PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591177.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 419aa    MW: 46073.4 Da    PI: 4.9944
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591177.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52e-064585339
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedCllee..Hkg..Htv 39
                      +C++++++++   C d +++lCe+C  +e    g  H++
  XP_009591177.1 45 SLICDKCSSQPAVVRCMDEEMCLCESCDWNEngCTGtgHRL 85
                    679************************97766654455665 PP

2CCT62.11.7e-21363406144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R +a++RY+eK+k+R F K+irYesRKa+A++R RvKGrFvk+ 
  XP_009591177.1 363 RHEAKMRYNEKKKSRTFGKQIRYESRKARADTRRRVKGRFVKAG 406
                     899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.717147IPR000315B-box-type zinc finger
SMARTSM003364.7E-8147IPR000315B-box-type zinc finger
CDDcd000211.94E-5347No hitNo description
CDDcd000210.004334775No hitNo description
PfamPF062031.1E-16363405IPR010402CCT domain
PROSITE profilePS5101714.574363405IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDPVCELCGV VRGLVYCKSD SARLCLQCDE NVHSANCLSR RHSRSLICDK CSSQPAVVRC  60
MDEEMCLCES CDWNENGCTG TGHRLKQLNP YNGSLSPTEF TRMLSEVLEI PDTNFGSFST  120
PCSSLSINEN SSLETKGNGG SLVANKLNEL ASNYKFDPWA IPSNVNCLTS YKRDPVPFSE  180
GSGFSKQDCP IKDLGFQEGD DLAKGVNFDD VTLSFDCGNY ELLGSSQQSH PIYSSEDKEL  240
DCLVMEKNSS VTGSNSHVET SLEATSSGPQ EYMGLQASQM AAAASSTNLF QTMSATANCM  300
LMNPSSIGLP FLPAPIHSSM SLSLSNITGE SSATTDYQDC GLSPVFLNGE SWDLNLEKSP  360
QKRHEAKMRY NEKKKSRTFG KQIRYESRKA RADTRRRVKG RFVKAGEAYD YDPSETKEF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327011e-46AC232701.2 Solanum lycopersicum chromosome 05 clone C05HBa0031K11, complete sequence.
GenBankHG9755171e-46HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591176.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like isoform X1
RefseqXP_009591177.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like isoform X1
RefseqXP_009591178.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like isoform X1
TrEMBLM0ZL890.0M0ZL89_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000031980.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.15e-96B-box type zinc finger protein with CCT domain